General Information

  • ID:  hor003526
  • Uniprot ID:  B6DT16
  • Protein name:  Orcokinin-3(1-11)
  • Gene name:  NA
  • Organism:  Rhodnius prolixus (Triatomid bug)
  • Family:  Orcokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rhodnius (genus), Triatominae (subfamily), Reduviidae (family), Reduvioidea (superfamily), Cimicomorpha (infraorder), Panheteroptera, Neoheteroptera, Euheteroptera, Heteroptera (suborder), Prosorrhyncha, Hemiptera (order), Paraneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NFDEIDRSGFN
  • Length:  11
  • Propeptide:  MSFFYSSAYAADKRNFDEIDRSGFNSFIKKKKNFDEIDRSGFDGFVKRNFDEIDRVGFGSFIKKSEPHH
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Myotropic
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-B6DT16-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003526_AF2.pdbhor003526_ESM.pdb

Physical Information

Mass: 149189 Formula: C56H80N16O21
Absent amino acids: ACHKLMPQTVWY Common amino acids: DFN
pI: 3.88 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -119.09 Boman Index: -4403
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 35.45
Instability Index: 5724.55 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  19137558
  • Title:  The neuropeptidome of Rhodnius prolixus brain.